freeze-thaw comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2026-06-13. Where a claim depends on a specific study, the study is described rather than over-claimed.
Peptide reconstitution refers to dissolving a dried peptide preparation in a liquid to form a solution. The dried form is often produced by lyophilization, a process that removes water under vacuum from a frozen sample. This yields a porous cake or powder that is more stable for transport and storage than many liquid formulations. The term reconstitution is also often used for other dried biological materials, so context matters greatly.
The choice of liquid depends on peptide sequence, counterion content, and intended analysis. Water is sufficient for many hydrophilic peptides, while hydrophobic sequences may need a small amount of organic solvent or a buffer. pH can affect charge, solubility, and stability, so the target value is usually selected for the specific peptide. Exact laboratory protocols vary by supplier and application, and no single solvent reliably works for every different peptide.
Quality control after reconstitution often includes visual inspection for particulates, pH measurement, and concentration determination by ultraviolet absorbance at 280 nm when aromatic residues are present. Reverse-phase high-performance liquid chromatography can assess purity and reveal degradation peaks. Mass spectrometry confirms molecular identity and detects modifications such as oxidation or truncation. Size-exclusion chromatography can quantify aggregates and oligomers. These methods are established for many peptides but may require optimization for hydrophobic or chemically modified sequences.
Microbial contamination is a concern for aqueous peptide solutions, especially those without preservatives. Bacteriostatic water contains an antimicrobial preservative and is used in some laboratory settings, while sterile water lacks preservatives. Filtration through a sterile filter can reduce particulates and microbes, but some peptides adsorb to filter membranes. The effect of preservatives on peptide stability is peptide-dependent and not fully predictable. Documentation of lot number, solvent, date, and storage conditions supports traceability and reproducibility.
After reconstitution, peptide solutions are generally less stable than lyophilized powders, and hydrolysis, oxidation, deamidation, and aggregation can occur in solution. Stability depends on peptide sequence, concentration, pH, buffer composition, temperature, light exposure, and dissolved oxygen. Many research protocols store reconstituted solutions at 4 °C for short periods or at -20 °C or -80 °C for longer periods. Repeated freeze-thaw cycles can promote aggregation and loss of activity. The optimal storage condition is peptide-specific and often determined empirically rather than predicted from sequence alone.
| Property | Value | Notes |
|---|---|---|
| Physical form | Lyophilized powder or cake | Appearance varies with fill and drying cycle |
| Common solvent | Sterile water or buffer | Buffer choice depends on peptide and assay |
| Solubility class | Variable; often water-soluble | Hydrophobic sequences may need co-solvent |
| Typical pH range | Peptide-dependent | Charge and stability can change with pH |
| Storage before use | 2–8 °C, desiccated | Follow supplier label; protect from moisture |
Analytical checks can detect changes in a reconstituted stock over time. Reverse-phase high-performance liquid chromatography can show loss of main peak, new impurity peaks, or altered retention. Mass spectrometry confirms molecular identity and can reveal modifications. Visual inspection for particles, color change, or turbidity provides a simple first check. If a solution shows signs of degradation or contamination, it is typically discarded rather than re-purified in a routine laboratory.
Once a peptide is dissolved, its solution is generally less stable than the dry powder. Chemical pathways such as hydrolysis, oxidation, and deamidation can alter the molecule, while physical processes can form aggregates or cause adsorption to container walls. The rate depends on pH, buffer composition, temperature, concentration, and the specific sequence. Aqueous stocks are therefore kept cold and used within a defined period. Stability testing is usually performed for each peptide rather than assumed from a general rule.
Cold storage slows most degradation but does not stop it. Reconstituted solutions are commonly divided into aliquots and held at -20 °C or -80 °C, depending on the peptide. Repeated freeze-thaw cycles can promote aggregation or precipitation, so single-use aliquots are preferred. Some peptides tolerate refrigeration for short intervals, while others require freezing immediately. Light-sensitive residues may need amber or foil-wrapped containers. The optimal condition remains peptide-specific and should be supported by stability data.
Solvent selection affects pH, ionic strength, and preservative content in the final liquid. Sterile water and bacteriostatic water containing benzyl alcohol are common in laboratory settings. Buffer systems may be used when a peptide is sensitive to pH shifts during dissolution. Acidic or basic conditions can change the net charge of ionizable groups and therefore solubility. Organic cosolvents are sometimes added for hydrophobic sequences, though they can also promote unfolding or aggregation.
During reconstitution, solvent penetrates the powder, breaks interparticle contacts, and solvates polar and nonpolar groups. Gentle mixing or swirling can speed dissolution, while vigorous shaking may introduce foaming and surface denaturation. Aggregation becomes more likely when the peptide concentration exceeds its solubility or when the pH is near the isoelectric point. The link between a specific reconstitution method and long-term stability is not fully predictable from sequence alone. How excipients, container surfaces, and residual moisture influence aggregation remains an open question.
The concentration of a reconstituted peptide is calculated from the mass of peptide powder and the volume of solvent added. This calculation assumes the powder contains only peptide, but many preparations include counterions, water, or salts. Analytical methods such as ultraviolet absorbance or amino acid analysis can estimate actual peptide content. The relationship between nominal and actual concentration is an area where measurements matter. Open questions remain about how aggregation changes the effective concentration in solution.
Peptide reconstitution is the process of dissolving a lyophilized peptide in a liquid to form a solution for later use. Lyophilization removes water under vacuum, leaving a dry powder or porous cake. Reconstitution reintroduces solvent so the peptide molecules return to a dissolved state. The solvent may be purified water, a buffer, or a mixture containing an organic co-solvent. The choice depends on the peptide sequence, its charge, and its hydrophobicity.
The choice of solvent is guided by peptide properties and the intended downstream use. Water alone can dissolve many hydrophilic peptides, while hydrophobic sequences may require a small amount of an organic solvent or a buffered solution. Some peptides carry net charges that affect solubility across pH values. The pH of the final solution can influence stability and aggregation. In research settings, the solvent is selected to match the assay or analytical method rather than for any therapeutic purpose.
During reconstitution, liquid is directed toward the wall of the vial rather than forcefully onto the powder. Gentle swirling or inversion mixes the contents without creating excessive foam or shear. Foaming can denature some peptides and can make volume measurement difficult. Complete dissolution is often confirmed by visual inspection against a light source. Particles, cloudiness, or undissolved material may indicate incomplete mixing, aggregation, or a solubility limitation that requires further investigation.
ASBMB hosts and sponsors numerous meetings each year. The annual meeting is held each April in conjunction with the Experimental Biology meeting. Additionally, themed special symposia are organized throughout the year. The society also produces webinars throughout the year focused on topics related to scientific research, professional development and education. The society offers twenty-five different awards, grants, and scholarships.
In biochemistry and molecular biology, a binding site is a region on a macromolecule such as a protein that binds to another molecule with specificity. The binding partner of the macromolecule is often referred to as a ligand. Ligands may include other proteins (resulting in a protein–protein interaction), enzyme substrates, second messengers, hormones, or allosteric modulators. The binding event is often, but not always, accompanied by a conformational change that alters the protein's function. Binding to protein binding sites is most often reversible (transient and non-covalent), but can also be covalent reversible or irreversible.
As there are two carbon atoms available for substitution, β-amino acids have four sites (chirality included; as opposed to two in α-amino acids) for attaching the organic residue group. Accordingly, two main types β-amino acids exist differing by which carbon the residue is attached to: ones with the organic residue (R) next to the amine are called β3 and those with position next to the carbonyl group are called β2. A β-peptide can consist of only one kind of these amino acids (β2-peptides and β3-peptides), or have a combination of the two. Furthermore, a β-amino acid can form a ring using both of its sites and also be incorporated into a peptide. β-Amino acids have been prepared by many routes, including some based on the Arndt-Eistert synthesis.
Some cecropins (e.g. cecropin A, and cecropin B) have anticancer properties and are called anticancer peptides (ACPs). Hybrid ACPs based on Cecropin A have been studied for anticancer properties. The fruit fly Defensin prevents tumour growth, suspected to bind to tumour cells owing to cell membrane modifications common to most cancer cells, such as phosphatidylserine exposure. Cecropin A can destroy planktonic and sessile biofilm-forming uropathogenic E. coli (UPEC) cells, either alone or when combined with the antibiotic nalidixic acid, synergistically clearing infection in vivo (in the insect host Galleria mellonella) without off-target cytotoxicity. The multi-target mechanism of action involves outer membrane permeabilization followed by biofilm disruption triggered by the inhibition of efflux pump activity and interactions with extracellular and intracellular nucleic acids. Recently there has been some research to identify potential antimicrobial peptides from prokaryotes, aquatic organisms such as fish, and shellfish, and monotremes such as echidnas.
Sources: en.wikipedia.org
Cytochrome-b5 reductase is a NADH-dependent enzyme that converts ferricytochrome from a Fe3+ form to a Fe2+ form. It contains FAD and catalyzes the reaction: In its b5-reducing capacity, this enzyme is involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, and drug metabolism. This enzyme can also reduce methemoglobin to normal hemoglobin, gaining it the inaccurate synonym methemoglobin reductase. Isoforms expressed in erythrocytes (CYB5R1, CYB5R3) perform this function in vivo. Ferricyanide is another substrate in vitro.
Clostridioides difficile has a highly diverse epigenome, with 17 high-quality methylation motifs reported so far, the majority pertaining to the 6mA type. Methylation at one of these motifs - CAAAAA, was shown to impact sporulation, a key step in C. difficile disease transmission, as well as cell length, biofilm formation, and host colonization. At least eight mainly temperate bacteriophages have been isolated from C. difficile, ranging in genome size from about 30 to about 60 kbp. Both environmentally and clinically derived C. difficile strains carry a diverse and prevalent set of prophages. Canada Pathogen Safety Data Sheets: Infectious Substances – Clostridium difficile, Public Health Agency, Canada, September 10, 2014. Type strain of Clostridium difficile, BacDive—the Bacterial Diversity Metadatabase
5-Hydroxyeicosanoid dehydrogenase (5-HEDH) or more formally, nicotinamide adenine dinucleotide phosphate (NADP+)-dependent dehydrogenase, is an enzyme that metabolizes between two eicosanoid metabolites of arachidonate 5-lipoxygenase (5-LOX): 5-hydroxyeicosatetraenoic acid (5-(S)-HETE), and its 5-keto analog 5-oxo-eicosatetraenoic acid (5-oxo-ETE). It also acts in the reverse direction, metabolizing 5-oxo-ETE to 5(S)-HETE. Since 5-oxo-ETE is 30–100-fold more potent than 5(S)-HETE in stimulating various cell types, 5-HEDH is regarded as a regulator and promoter of the influence that 5-LOX and its metabolites have on cell function. Although 5-HEDH has been evaluated in a wide range of intact cells and in crude microsome preparations, it has not yet been evaluated for its structure or gene, and most studies on it have been limited to human tissues.
Adenosine triphosphate (ATP) is a nucleoside triphosphate that provides free energy of approximately 58 kJ/mol (0.6 eV) to drive and support many processes in living cells, such as muscle contraction, nerve impulse propagation, and chemical synthesis. Found in all known forms of life, it is often referred to as the "molecular unit of currency" for intracellular energy transfer. When consumed in a metabolic process, ATP converts either to adenosine diphosphate (ADP) or to adenosine monophosphate (AMP). Other processes, such as oxidative phosphorylation or substrate-level phosphorylation, regenerate ATP. ATP is also a precursor to DNA and RNA, and is used as a coenzyme. Daily, an average adult human recycles through synthesis and hydrolysis around 50 kilograms of ATP (about 100 moles). From the perspective of biochemistry, ATP is classified as a nucleoside triphosphate, which indicates that it consists of three components: a nitrogenous base (adenine), the sugar ribose, and the triphosphate.
Aβ is the main component of the kind of amyloid plaques that form in the brains of people with Alzheimer's disease. Aβ can also form the deposits that line cerebral blood vessels in cerebral amyloid angiopathy. The plaques are composed of aggregated Aβ oligomers called amyloid fibrils, a protein fold shared by other peptides such as the prions associated with protein misfolding disease, also known as proteinopathy.
Sources: en.wikipedia.org
In March 2003, Cambridge Antibody Technology (CAT) stated its wish to "initiate discussions regarding the applicability of the royalty offset provisions for Humira" with Abbott Laboratories in the High Court of London. In November 2004, the trial began, and in December 2004, Justice Hugh Laddie ruled for CAT. A short version of the full statement of the proceedings was released. In it Justice Laddie remarked, "Abbott was in error when it made its first royalty payment to CAT calculated on the basis that only 2% of the Net Sales was due. It should have calculated on the basis of the full royalty of just over 5% and should have paid and continued to pay CAT accordingly." Justice Laddie went on to observe "...that the construction advanced by Abbott does violence to the language of the agreements, renders them obscure and makes little or no commercial sense. For this reason CAT wins the action." Abbott was required to pay CAT US$255 million, some of which was to be passed to its partners in development. Of this sum, the Medical Research Council received US$191 million, and in addition, Abbott was asked to pay the MRC a further US$7.5 million over five years from 2006, providing that Humira remains on the market. The MRC also is to receive a further £5.1 million (sterling) in respect of past royalties.
Network Science, Part 5: Solvent-Accessible Surfaces AREAIMOL is a command line tool in the CCP4 Program Suite for calculating ASA. NACCESS solvent accessible area calculations. FreeSASA Open source command line tool, C library and Python module for calculating ASA. Surface Racer Oleg Tsodikov's Surface Racer program. Solvent accessible and molecular surface area and average curvature calculation. Free for academic use. ASA.py — a Python-based implementation of the Shrake-Rupley algorithm. Michel Sanner's Molecular Surface – the fastest program to calculate the excluded surface. pov4grasp render molecular surfaces. Molecular Surface Package — Michael Connolly's program. Volume Voxelator — A web-based tool to generate excluded surfaces. ASV freeware Analytical calculation of the volume and surface of the union of n spheres (Monte-Carlo calculation also provided). Vorlume Computing Surface Area and Volume of a Family of 3D Balls. GetArea Calculate solvent accessible surface area of proteins online. ProMS ProMS - Protein Molecular Surface Calculator
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Amanda Grace Paulovich is an oncologist, and a pioneer in proteomics using multiple reaction monitoring mass spectrometry to study tailored cancer treatment. Paulovich received a BS in Biological Sciences from Carnegie Mellon University in 1988, a PhD in Genetics from University of Washington in 1996, under the direction of Leland Hartwell. She also received a MD from University of Washington in 1998. Follow her residency in Internal Medicine at Massachusetts General Hospital, she also completed a Postdoctoral Fellowship in Computational Biology at the Massachusetts Institute of Technology Whitehead Center for Genomic Research in 2003, and a Fellowship in Medical Oncology at the Dana Farber Cancer Institute in 2004.
Sources: en.wikipedia.org
It is the process of dissolving a dried peptide preparation in a suitable liquid to obtain a solution. The liquid is often water, a buffer, or a water-organic mixture. The procedure is common in laboratory research and analytical work.
Drying reduces water content and can limit chemical degradation during shipping and storage. Lyophilized peptides are typically more stable than solutions at similar temperatures. The dried form also allows a defined mass to be weighed before liquid is added.
No. Hydrophilic peptides often dissolve readily in water, but hydrophobic or aggregated sequences may require buffer, pH adjustment, or organic co-solvent. Solubility depends on sequence, counterions, and purity. A trial in a small volume can reveal whether a chosen liquid is suitable.
There is no universal duration because stability varies widely by peptide. Short-term storage at refrigerated temperatures and longer-term storage at frozen temperatures are common in research settings. Degradation markers should be checked periodically.